SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022103 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022103
Domain Number 1 Region: 31-182
Classification Level Classification E-value
Superfamily C-type lectin-like 9.28e-20
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 2 Region: 257-385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000283
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 420-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000032
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 4 Region: 383-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000611
Family EGF-type module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022103   Gene: ENSMMUG00000016813   Transcript: ENSMMUT00000023622
Sequence length 651
Comment pep:known chromosome:MMUL_1:10:56372303:56375863:-1 gene:ENSMMUG00000016813 transcript:ENSMMUT00000023622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSVGLLLLLLLLLRQLGAGTGADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNL
ATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGG
EDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVC
KFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLC
KEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTC
ASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVN
TPGSFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGE
DGTQCQDVDECVGPGGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGP
PDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGS
PGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKLLLFYILGTVVGILLLLALA
LGLLVYRKRRAKREEKKEKPQNAADSYSWVPERAESRAMENQYSPTPGTDC
Download sequence
Identical sequences A0A2K5VH53 A0A2K6DST0 I2CWP4
XP_005568246.1.63531 XP_011748129.1.29376 ENSMMUP00000022103 ENSMMUP00000022103 9544.ENSMMUP00000022103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]