SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022104 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022104
Domain Number 1 Region: 20-176
Classification Level Classification E-value
Superfamily C-type lectin-like 1.07e-18
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 400-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000117
Family EGF-type module 0.0004
Further Details:      
 
Domain Number 3 Region: 242-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 360-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.0002
Further Details:      
 
Domain Number 5 Region: 436-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000284
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022104   Gene: ENSMMUG00000016814   Transcript: ENSMMUT00000023623
Sequence length 570
Comment pep:known chromosome:MMUL_1:10:56337719:56339431:-1 gene:ENSMMUG00000016814 transcript:ENSMMUT00000023623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGVLLLGVLTLAGPGFPAPVEPQPGGSQCVEHDCFALYPGPATFLDASQICNRLRGHLM
TVRSSVAADVISLLLSGDRGVSRRLWIGLQLPPGCGDPKPLGPLRGFEWVTRDSNTSYSR
WARLDLNGAPPCGPLCVAVSAAGATAPGEPVWEEQQCDVKADGFLCEFYFPATCRPLAVK
PGAATAAVSITYRTPFAARGADFQALPVGSSAAVAPLGLELMCAAPPKAVQGHWAREAPG
AWDCSVENGGCEHACNTIAGAPRCLCPAGAALQADGRSCTHSCNNLCEHFCVPNPDKPDS
YSCMCETGYRLAADQHRCEDVDDCLLVPSPCPQRCVNKQGGFECHCKPGYDLVDGECVEP
VDPCFKANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPNTRGNC
ECPDGYILDDGFMCSDIDECENGGYCSGVCLNLPGTFECICGPDSARVRLIGKDCDSAEV
DGGDDGSGEPPRGPTPGCTSSPPAVGRVHSGVLIGISIASLCLVVALLALLCHLRKKQGA
ARAKMEYKCAAPSKEVVLQSVRTERKPQRL
Download sequence
Identical sequences F7C9T2
NP_001252978.1.72884 9544.ENSMMUP00000022104 ENSMMUP00000022104 ENSMMUP00000022104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]