SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022204 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022204
Domain Number 1 Region: 778-869
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000156
Family Canonical RBD 0.021
Further Details:      
 
Domain Number 2 Region: 10-53
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000053
Family LEM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022204   Gene: ENSMMUG00000016892   Transcript: ENSMMUT00000023726
Sequence length 909
Comment pep:known chromosome:MMUL_1:11:62218117:62296547:1 gene:ENSMMUG00000016892 transcript:ENSMMUT00000023726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRG
NKTRNSNNNNTAAATVVAAGPAAAAAAGMGVRPVAGDLSYLRTPGGLCRISASGSENLLG
GPGGASAAPTAGSKVLLGFSSDESDVEASPRDQAGGGGRKDRASLQYRGLKAPPAPLAAS
EVTNSNSAERRKPHSWWGARRPAGPDLQTPPGKDGAVEDEEGEGEDGEERDPEAEEPLWA
SRTVNGSRLVPYSCRENYSDSEEEDDDDVASSRQVLKDDSVSRHRPRRTHSKPLSPLTAK
SAGGRLETSVQGGGGHAMNDRAAAAGSLDRSRNLEEAAEQGGGCDQVDSSPVPRYRVNAK
KLTPLLPPPLTDMDSTLDSSTGSLLKTNNHIGGGAFNVDSPRIYSNSLPPSAAVAAASSL
RINHANHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGSFSAHYLSMFLLTAAC
LFFLILGLTYLGMRGTGVSEDGKLSIENPFGETFGKIQESEKILMMNTLYKLHDRLAQLA
GDHECGSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPEEEL
TNITDVQFLQSTRPLMSFWCRFRRAFVTVTHRLLLLCLGVVMVCVVLRYMKYRWTKEEEE
TRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDF
LAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPNSL
TPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPE
YAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRLRT
GLTNSQGSS
Download sequence
Identical sequences H9Z766
NP_001245023.1.72884 ENSMMUP00000022204 ENSMMUP00000022204 9544.ENSMMUP00000022204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]