SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022210 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022210
Domain Number 1 Region: 43-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000267
Family I set domains 0.087
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022210
Domain Number - Region: 156-197
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0509
Family Gelsolin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022210   Gene: ENSMMUG00000016897   Transcript: ENSMMUT00000023732
Sequence length 252
Comment pep:known_by_projection chromosome:MMUL_1:16:77805608:77810716:-1 gene:ENSMMUG00000016897 transcript:ENSMMUT00000023732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTWPLVFPGPVSWPFGALLLLAASLSAQNEGWDSPICTEGVVSVSRGENTVMTCNISNA
FSHVIIKLRAQGQESTIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGTRDSHAGLYTWHLV
GRQRNNRQVTLEVSGGAEPQSTPDAGSWPVPVVVTAVFILLVLTVMFAWYRCRCSQQRQE
GAVRSGFDLQRAQKTPVLRVGVQQGLSRASPGLWTPDPKPTPRPPALVVKPSALGALELL
SPQPLFPDAIDP
Download sequence
Identical sequences 9544.ENSMMUP00000022210 ENSMMUP00000022210 ENSMMUP00000022210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]