SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022266 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022266
Domain Number 1 Region: 380-572
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.77e-47
Family cAMP-binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 134-379
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-37
Family Voltage-gated potassium channels 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022266   Gene: ENSMMUG00000016932   Transcript: ENSMMUT00000023789
Sequence length 664
Comment pep:known_by_projection chromosome:MMUL_1:X:149812383:149823202:1 gene:ENSMMUG00000016932 transcript:ENSMMUT00000023789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKANGVKSSPVNNHNHHAPPAIKANGKDDHRTSSRPHSAADDDTSSELQRLADVDAHS
GEGVGFPQVVRLVGIIREWANKNFREEEPRPDSFLERFRGPELQTVTTQQGDGKGDKDGK
DKGTKKKFELFVLDPAGDWYYCWLFVIAMPVLYNWCLLVARACFSDLQKDYYLVWLVLDY
VSDVVYIADIFIRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDVASIIPTDLIYFAVGI
HSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEAKVIRWFDYLWTNK
KTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFHDCEAGLLVELVLKLRPQVFSPGDY
ICRKGDIGKEMYIIKEGRLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI
RSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEK
LGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITILETKMKQNNEDDYLSDGMSSPELAA
ADKP
Download sequence
Identical sequences ENSMMUP00000022266 9544.ENSMMUP00000022266 ENSMMUP00000022266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]