SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022281 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022281
Domain Number 1 Region: 566-809
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.6e-82
Family Eukaryotic proteases 0.00000000894
Further Details:      
 
Domain Number 2 Region: 366-466
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-39
Family Kringle modules 0.00000758
Further Details:      
 
Domain Number 3 Region: 89-183
Classification Level Classification E-value
Superfamily Kringle-like 1.16e-36
Family Kringle modules 0.0000114
Further Details:      
 
Domain Number 4 Region: 272-364
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-36
Family Kringle modules 0.00000778
Further Details:      
 
Domain Number 5 Region: 466-563
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-34
Family Kringle modules 0.00000693
Further Details:      
 
Domain Number 6 Region: 183-266
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-34
Family Kringle modules 0.00000577
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.92e-21
Family Hairpin loop containing domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022281   Gene: ENSMMUG00000016945   Transcript: ENSMMUT00000023806
Sequence length 810
Comment pep:known chromosome:MMUL_1:4:157592471:157641186:1 gene:ENSMMUG00000016945 transcript:ENSMMUT00000023806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTKGASLFSITKKQLGAGSIEECAAKCEEEEEFT
CRSFQYHSKEQQCVIMAENRKSSIVFRMRDVVLFEKKVYLSECKTGNGKSYRGTMSKTRT
GITCQKWSSTSPHRPKFSPATHPSEGLEENYCRNPDNDGQGPWCYTTDPEERFDYCDIPE
CEDECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDGE
PRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGDVAVTVSGHTCQRWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGEKAPWCYTTNSQVRWEYCKIPSCESSPVSTE
PLDPTAPPELTPVVQECYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHWHEKTPENFPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEGSVAAPPPVAQLPDAETPSEED
CMFGNGKGYRGKKATTVTGTPCQEWAAQEPHSHRIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLFDYCDVPQCAASSFDCGKPQVEPKKCPGRVVGGCVAYPHSWPWQISLRT
RLGMHFCGGTLISPEWVLTAAHCLEKSSRPSFYKVILGAHREVHLEPHVQEIEVSKMFSE
PARADIALLKLSSPAIITDKVIPACLPSPNYVVADRTECFITGWGETQGTYGAGLLKEAR
LPVIENKVCNRYEFLNGRVKTTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Download sequence
Identical sequences A0A2K5TJJ6 F7CC91
XP_005551555.1.63531 ENSMMUP00000022281 ENSMMUP00000022281 9544.ENSMMUP00000022281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]