SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022381 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022381
Domain Number 1 Region: 35-295
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.07e-96
Family Inorganic pyrophosphatase 0.000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022381   Gene: ENSMMUG00000017004   Transcript: ENSMMUT00000023910
Sequence length 296
Comment pep:known_by_projection chromosome:MMUL_1:5:98443228:98533015:-1 gene:ENSMMUG00000017004 transcript:ENSMMUT00000023910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGPRRAMALYHTEERGQPCSQNYRLFFKDVTGHYI
SPFHDIPLKVNSKEENGIPTKKARNDEYEIATEEPLNPIKQYVKDGKLRYVANIFPYKGY
IWNYGTLPQTWEDPGEKDKSTNCFGDNDPIDVCEIGSKILSCGEVIHVKILGILALIDEG
ETDWKLIAINVNDPEASKFHDIDDVEKFKPGYLEATLNWFRLYKVPDGKPENQFAFNGEF
KNKAFALEVIKSTHQCWKALLMKKCNGGAINCTNVQISDSPFRCTQEEARSLVESV
Download sequence
Identical sequences ENSMMUP00000022381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]