SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022489 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022489
Domain Number 1 Region: 662-812
Classification Level Classification E-value
Superfamily C-type lectin-like 8.92e-44
Family C-type lectin domain 0.00000556
Further Details:      
 
Domain Number 2 Region: 151-265
Classification Level Classification E-value
Superfamily C-type lectin-like 1.53e-42
Family Link domain 0.0051
Further Details:      
 
Domain Number 3 Region: 267-360
Classification Level Classification E-value
Superfamily C-type lectin-like 1.48e-30
Family Link domain 0.0067
Further Details:      
 
Domain Number 4 Region: 44-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000215
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 
Domain Number 5 Region: 812-871
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000403
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022489   Gene: ENSMMUG00000017093   Transcript: ENSMMUT00000024031
Sequence length 910
Comment pep:known_by_projection chromosome:MMUL_1:1:135250211:135267756:1 gene:ENSMMUG00000017093 transcript:ENSMMUT00000024031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLLLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRISGHAPLQGVLGGALTIPCHVH
YLRPPPSRRAVLGSPRVKWTFLSGGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDV
SLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFVGAQEACA
RIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDR
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPS
AIPEASNPASDPASDGLEAIVTVTETLEELQLPQEAMESESRGAIYSIPIMEDGGGGSST
PEDPAEAPRTVPEFETQSMVPPTVFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALW
AWPSEFNSPGPEVSLPTEPAAQESLSQAPARAVLQPGVSPLPDGESETPRPPRVHGPPTE
TLPSPRERNLASPSPSTLAGAREAGEETGGPELSGVPRGESEETGSSEGAPSLLPATRAP
EGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAMVPASGDCVPSPCHNGGTC
LEEEEGIRCLCLPGYGGDLCDVGLSFCNPGWDAFQGSCYKHFSTRRSWEEAETQCRMYGA
HLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSG
ENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVLR
YRCREGLAQRNLPLIRCQENGRWETPQISCVPRRPARALHPEKDPEGRQGRLLGRWKALL
IPSSSPTPGP
Download sequence
Identical sequences 9544.ENSMMUP00000022489 ENSMMUP00000022489 XP_001116679.1.72884 ENSMMUP00000022489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]