SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022494 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022494
Domain Number 1 Region: 208-313
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-31
Family Link domain 0.0067
Further Details:      
 
Domain Number 2 Region: 150-206
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000344
Family Link domain 0.057
Further Details:      
 
Domain Number 3 Region: 44-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000188
Family V set domains (antibody variable domain-like) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022494   Gene: ENSMMUG00000017093   Transcript: ENSMMUT00000024036
Sequence length 514
Comment pep:known_by_projection chromosome:MMUL_1:1:135250391:135267756:1 gene:ENSMMUG00000017093 transcript:ENSMMUT00000024036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLLLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRISGHAPLQGVLGGALTIPCHVH
YLRPPPSRRAVLGSPRVKWTFLSGGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDV
SLALSELRPNDSGIYRCEVQHGIDDSSDAVEDSELYPIQTPREACYGDMDGFPGVRNYGV
VDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLD
RCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRGSTCL
LPFLRPPTQLPTQDGLEAIVTVTETLEELQLPQEAMESESRGAIYSIPIMEDGGGGSSTP
EDPAEAPRTVPEFETQSMVPPTVFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALWA
WPSEFNSPGPEVSLPTEPAAQESLSQAPARAVLQPGVSPLPDGESETPRPPRVHGPPTET
LPSPRERNLASPSPSTLAGAREAGEETGGPELSG
Download sequence
Identical sequences ENSMMUP00000022494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]