SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022583 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022583
Domain Number 1 Region: 1257-1419,1447-1526
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.68e-41
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 747-973
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 85-241,338-405
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.22e-35
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1581-1784
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-29
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022583   Gene: ENSMMUG00000017256   Transcript: ENSMMUT00000024136
Sequence length 2177
Comment pep:known chromosome:MMUL_1:16:34802861:34868421:1 gene:ENSMMUG00000017256 transcript:ENSMMUT00000024136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRRGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVSVSLTARTWFERISMLVILLNCVTLGMFRPCEDIACDSQRCR
ILQAFDDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVS
FSAVRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAG
LLRNRCFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGEGGGG
PPCGLDYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEG
WVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVR
FLSNASTLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRAGLLSSPAPLGGQE
TQPSSSCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRVPRASPEIQDRDANGSRRLMLP
PPSTPAVSGGPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHT
SPPPETLKEKALVEVAASSGPATLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCL
KADSGASGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRS
LGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNAL
EISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRT
FRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASER
DGDTLPDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVL
FNLLVAILVEGFQAEGDANKSESEPDFFSPSLDGDGDRKKCLALVSLGEHPELRKSLLPP
LIIHTAATPMSLPKSTSTGLGEALGPMSRRTSSSGSAEPGAAHEMKSPPSARSSPHSPWS
AASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQDEEESSEEERASPAGSDC
RHRESLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCNGKSASGRLARALRPDDPP
LDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFPPQSRFRLLCHRIITHKMF
DHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAVFLAEMTVKVVALGWCFGE
QAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVLRLLRTLRPLRVISRAQGL
KLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEA
SYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFI
SFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLRRLEKKRRSKEKQMAEAQ
CKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQILDEALKICNYI
FTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLLSIMGITLEEIEVNASLPINPTIIR
IMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLFMLLFFIFAALGVELFGDLE
CDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMKVTVPLCCARSPDRAGLVFPA
HWVSVESAASGPQLSARDKGICKNLEEKRGDAAEDNPPEALLAIRLAALSPAPPMPLFSL
CIWSPVQASPPCPCPPPPHPTHNMRPSHHVVREPAVQPHPTELPGPDLLTVRKSGVSRTH
SLPNDSYMCRHGSIAEGPLGQRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAPHLLQP
YSTPTWGTIPKLPPPGRSPLAQRPLRRQAGLELPTSSDLPALASQRDLLPPGGQEEPPSP
RDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGS
RPKKKLSPPSISIDPPESQGPRPPPSPGVCLRRRAPSSDSKDPLASGPPDSMAASPSPKK
DVLSLSGLSSDPADLDP
Download sequence
Identical sequences ENSMMUP00000022583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]