SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022693 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022693
Domain Number 1 Region: 1130-1286
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.33e-51
Family Complement components 0.0000563
Further Details:      
 
Domain Number 2 Region: 801-912
Classification Level Classification E-value
Superfamily E set domains 0.00000000952
Family SVA-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022693   Gene: ENSMMUG00000017254   Transcript: ENSMMUT00000024249
Sequence length 1288
Comment pep:known_by_projection chromosome:MMUL_1:19:16472358:16571591:-1 gene:ENSMMUG00000017254 transcript:ENSMMUT00000024249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCALLWPLLPLLLLLLSARDGVRAAQPQAPGYLIAAPSVFRAGVEEVISVTIFNSPWEV
IVQAQLVAQGEPVVQSQGAILDKGTIKLKVPTGLRGQALLKVWGRGRQAEEDPLFHNQTS
VTVDGRGASVFIQTDKPVYRPQHRVLISIFTVSPDLRPVNEKGHHWKLDPRGSRMIEWRH
LKPFCCGITNLSFPLSDQPVLGEWFIFAEMQGHTYNKSFEVQKYVLPKFELLIDPPRYIR
DLDACETGTVRASISLSCDSPPVGAPSLGWTLCTIGYVTNEHGLRFSSLQILGSQDFDIC
VRDMIPADVPEHFRGRVSIWATVTSVDGSQQVAFDDSTPVQRQLVDIRYSKDTRKQFKPG
LAYVGKVELSYPDGSPAEGVTVQIKAELTPKDNIYTSEAVSQGGLVGFEIPSIPTSAQHV
WLETKVTALNGKPVGAQYLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEADFSVKSTCP
CNFTLYYEVAARGNIVLSGQQPAHVTQQRSKRAAPALEKPIRLTHLSETEPPPAPAAEVN
VCVTSLHLAVTPSMVPLGRLLVFYVRENGEGVADSLQFAVETFFENQVSVTYSANETQPG
EVVDLRIRAARGSCVCVAAVDKSVYLLRSGFRLTPAQVFQELEDYDVSDSFGVSREDGPF
WWAGLMAQRRRRSSVFPWPWGITKDSGFAFTETGLVVMTDRVSLNHRQDGGLYTDEAVPA
FQPHTGSLVAAAPSRNPPRTEKRKRTFFPETWIWYCLNISDPSGEETLSVKVPDSITSWV
GEATALSTSQGLGIAEPSLLKTFKPFFVDFTLPRLIIRGEQVKIPLSVYNYMGICAEVYM
KLSVPKGIQFVGHPGKRHLTKKMCVAPGEAEPIWVVLSFSDLGLNNITAKALAYGDTNCC
RDGRSSKPPEENHADRRVPIGVDHVRRSVMVEAEGVPRAYTYSAFFCPSERVHISTPNKY
EFQYVQRPLHLTRFDVAVRAHNDARVALSSGPQDTAGMIEIVLGGHQNTRSWISTSKMGE
PVASAHTAKILSWDEFRTFWISWHGGRIQVGHGPEPSNESVIVAWTLPRPPEVQFIGFST
GWGSMGEFRIWRKMEVDESYSEAFTLGVPHGAIPGSERAAASIIGDVMGPTLNHLNNLLR
LPFGCGEQNMIHFAPNIFVLKYLQKTQQLSPEVERETTDYLVQGYQRQLTYKRQDGSYSA
FGERDASGSMWLTAFVLKSFAQARSFIFVDPREVAASKSWIIQQQQADGSFPAVGRVLNK
DIQGGIHGTVPLTAYVVVALLETGTASE
Download sequence
Identical sequences ENSMMUP00000022693 9544.ENSMMUP00000022693 ENSMMUP00000022693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]