SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022772 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022772
Domain Number 1 Region: 2-219
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.1e-31
Family Rhodopsin-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022772   Gene: ENSMMUG00000017309   Transcript: ENSMMUT00000024330
Sequence length 230
Comment pep:known_by_projection chromosome:MMUL_1:1:73605531:73806493:-1 gene:ENSMMUG00000017309 transcript:ENSMMUT00000024330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGV
GQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLLALTVTFACNLATIKAL
VSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVEHCK
THTGKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQEDPAVSS
Download sequence
Identical sequences ENSMMUP00000022772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]