SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022777 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022777
Domain Number 1 Region: 2-40
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000000000173
Family Ran binding protein zinc finger-like 0.00013
Further Details:      
 
Domain Number 2 Region: 58-95
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000000204
Family Ran binding protein zinc finger-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022777   Gene: ENSMMUG00000017312   Transcript: ENSMMUT00000024335
Sequence length 336
Comment pep:known chromosome:MMUL_1:1:73826707:73844227:-1 gene:ENSMMUG00000017312 transcript:ENSMMUT00000024335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKS
RGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREES
DGEYDEFGRKKKKYRGKAVGPASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADL
SKYNLDASEEEDSNKKKSNRRSRSKSRSSHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSR
SRSSSRERSRSRGSKSRSSSRTGALLPHEKDLIQVHHLLLRGTEREVVLDLLHLVIAKKD
EQDHGHPKDATGHLLDHPILVPVQVQKRNNVLKFTS
Download sequence
Identical sequences ENSMMUP00000022777 9544.ENSMMUP00000022777 ENSMMUP00000022779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]