SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022779 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022779
Domain Number 1 Region: 2-40
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000000000157
Family Ran binding protein zinc finger-like 0.00013
Further Details:      
 
Domain Number 2 Region: 58-95
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000000188
Family Ran binding protein zinc finger-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022779   Gene: ENSMMUG00000017312   Transcript: ENSMMUT00000024337
Sequence length 320
Comment pep:known chromosome:MMUL_1:1:73829118:73844219:-1 gene:ENSMMUG00000017312 transcript:ENSMMUT00000024337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKS
RGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREES
DGEYDEFGRKKKKYRGKAVGPASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADL
SKYNLDASEEEDSNKKKSNRRSRSKSRSSHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSR
SRSSSRERSRSRGSKSRSSSRSHRGSSSPRKRSYSSSSSSPERNRKRSRSRSSSSGDRKK
RRTRSRSPESQVIGENTKQP
Download sequence
Identical sequences A0A096MR64 A0A2I3G9J6 A0A2K5C133 A0A2K5JBL1 A0A2K5L653 A0A2K5RV27 A0A2K5W9B9 A0A2K5ZAX2 A0A2K6DQG8 A0A2K6S5N7 F7HS64 G3RPF8 H2PZ84 M3XPB1 Q5R580
NP_001127628.1.23681 NP_005446.2.87134 NP_005446.2.92137 XP_003260243.1.23891 XP_003308198.1.37143 XP_003830649.1.60992 XP_003921466.1.74449 XP_004026019.1.27298 XP_004280781.1.21590 XP_004408047.1.74151 XP_005543085.1.63531 XP_005678322.1.57651 XP_005970201.1.78601 XP_006727953.1.47382 XP_006919383.1.64745 XP_007976489.1.81039 XP_008570052.1.73410 XP_011235988.1.58354 XP_011364000.1.92234 XP_011768742.1.29376 XP_011792297.1.43180 XP_011833004.1.47321 XP_011937638.1.92194 XP_014947535.1.66739 XP_014963288.1.54773 XP_014997766.1.72884 XP_016004413.1.101085 XP_017387372.1.71028 XP_019583308.1.88060 XP_019775247.1.83887 XP_020747376.1.74333 XP_021523442.1.9421 XP_021533829.1.83697 ENSP00000254821 ENSP00000482026 ENSP00000254821 ENSPTRP00000001487 ENSMPUP00000000911 gi|42741682|ref|NP_005446.2| ENSMPUP00000000911 ENSMMUP00000022779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]