SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022802 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022802
Domain Number 1 Region: 19-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000465
Family C2 set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022802   Gene: ENSMMUG00000017327   Transcript: ENSMMUT00000024363
Sequence length 228
Comment pep:known_by_projection chromosome:MMUL_1:1:139382735:139396915:1 gene:ENSMMUG00000017327 transcript:ENSMMUT00000024363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSPTCFTFIYILWQLTEHLSKPKVTMGLQSNKNGTCVTNLTCHMEHGEEDVIYTWKAL
GQAVNESHNGSILPISWRWGESDMTFICTVRNPVSSNSSSPILARKLCEGAADDSDSSMV
LLCLLLVPLLLSLFVLGLFLWFLKRETQEESIEEKKRADICRETPNICPYSGENTEYDTI
PYTNRTIPMEDAANTLYSTVEIPKKIENPHSLLTMPDTPRLFAYENVI
Download sequence
Identical sequences ENSMMUP00000022802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]