SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022843 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022843
Domain Number 1 Region: 2197-2290
Classification Level Classification E-value
Superfamily C-type lectin-like 1.39e-33
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1461-1509,1590-1701
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-28
Family FAS1 domain 0.003
Further Details:      
 
Domain Number 3 Region: 516-635
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-25
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 4 Region: 1703-1856
Classification Level Classification E-value
Superfamily FAS1 domain 2.62e-25
Family FAS1 domain 0.0042
Further Details:      
 
Domain Number 5 Region: 953-1109
Classification Level Classification E-value
Superfamily FAS1 domain 8.76e-22
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 6 Region: 2288-2451
Classification Level Classification E-value
Superfamily FAS1 domain 8.89e-17
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 7 Region: 330-455
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000157
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 8 Region: 1128-1219
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000183
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 9 Region: 1533-1570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Merozoite surface protein 1 (MSP-1) 0.052
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022843
Domain Number - Region: 891-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 1998-2125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 1359-1490
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000957
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 196-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00283
Family Merozoite surface protein 1 (MSP-1) 0.035
Further Details:      
 
Domain Number - Region: 818-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-like domain of nidogen-1 0.072
Further Details:      
 
Domain Number - Region: 1965-1998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 852-899
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00716
Family EGF-like domain of nidogen-1 0.078
Further Details:      
 
Domain Number - Region: 2129-2164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0129
Family EGF-like domain of nidogen-1 0.06
Further Details:      
 
Domain Number - Region: 228-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022843   Gene: ENSMMUG00000017351   Transcript: ENSMMUT00000024407
Sequence length 2559
Comment pep:known chromosome:MMUL_1:2:83850104:83880084:-1 gene:ENSMMUG00000017351 transcript:ENSMMUT00000024407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPQGLLPLCLLAFCLAVFIRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWLRE
LPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPCNG
HGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGMCNRGPRGDGSCL
CFAGYTGPHCDQELPICQELRCPQNTQCSAEAPSCKCLPGYTQQGSECRAPNPCWPSPCS
PLALCSVSPKGQAQCHCSENYHGDGIVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFCTC
RPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLLHE
VQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSISSFSSRTMNASLAQQLCR
QHIIAGQHILEDTRTQQTRKWWTLAGQEITVTFNQFTVREKPQPGNKRSHSRPGVVAHAC
NPSTLGRPRWADHKGPGRTQRWRLAMQPPASLAPPQNCGLPSILDGPGPFTVFAPSNEAV
DSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMANQVLAVNISEEG
RILLGPEGVPLQRVDVLAANGVIHMLDGILLPPTILPILPKHCSEEQHKIVAGSCVDCQA
LNTSMCPHNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTVTEQGCCKGFFGPDCTQ
CPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGDQCQEDCGCVHGLC
DNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQHCHLHARCVSQEGVARCRCLDG
FEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGRVCVAIDECELD
VRGGCHADALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHGLATCRAVGGGQ
RVCTCPPGFGGDGFSCYGDIFRELEANAHFSIFYQWFKSAGITLPADGRVTALVPSEAAV
RQLNPEERAFWLQPRMLPSLVRAHFLQGALFEEELARLGGQEVATLNPTTHWEIRNISGR
VWVQNASVDVADLLATNGVLHILSQVLLPSRGDVPGGQGLLQQLDLVPAFSLFRELLQRH
RLVSQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSMETLRKGGHRNSL
LGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRCLHSHAEALREK
CVNCTKKFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDCCPGFFGTLCEP
CPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEMCELGRYGPNCTGVCDCAHGLCQ
EGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASICACAAGYSGNGV
FCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINSCLIHHGGCHIH
AECIPTGPQQVSCSCREGYRGDGIRTCELLDPCSKNNGGCSPYATCKSTGDGQRTCTCDT
ANTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPHADLMSNLSQDE
LARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGSIYLNDFARVVS
SDHEAVNGILHFIDRVLLPPDALHWEPDDEPIPRRNVTAAAQGFGYKIFSGLLKVASLLP
LLREASHRPFTMLWPTDAAFRALPPDRQAWLYHEDHRDKLAAILRGHMIRNVEALASDLP
NLGPLRTMHGTPISFACSRTRPGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGA
RCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRLYPKFWTSPPLRSLGLHSVWV
QHSLWARPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCSDRGMCMDGMSG
SGQCLCRSGFAGTACELCAPGAFGPHCQACRCTVHGRCDEGLGGSGSCFCDEGWTGSHCE
VQLELQPVCTPPCAPKAVCRAGNSCECSLGYEGDGRVCTVADLCQDGHGGCSEHANCSQV
GTAVTCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHADCLSTGLNTRRCECHAGYVGDGL
QCLEELEPPVDRCLGRPPPCHSDAVCTDLHFQEKRAGVFHLQATSGPYGLNFSEAEAACK
AQGAVLASFPQLSAAQQLGFHLCLMGWLANGSAAHPVVFPVADCGNGRVGIVSLGARKNL
SERWDAYCFRVQDVACRCRDGFVGDGISTCNGKLLDVLAATANFSTFYGMLLGYANATQR
GLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANASQGKLLPAHS
GLSLIISDAGPDNSSWAPVAPGTVVVSHVIVWDIVAFNGIIHALASPLLAPPQPQAVLAP
KAPPVAAGVGAVLAAGALLGLVAGALYLRAQGKPTGFGFSAFQAEEDAADDFSPWQEGTN
PTLVSVPNPVFGSDTFCEPFHDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences ENSMMUP00000022843 9544.ENSMMUP00000022843 ENSMMUP00000022843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]