SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022940 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022940
Domain Number 1 Region: 59-88,117-200
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-16
Family Canonical RBD 0.01
Further Details:      
 
Domain Number 2 Region: 279-385
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000103
Family Canonical RBD 0.0064
Further Details:      
 
Domain Number 3 Region: 208-236
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000012
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022940
Domain Number - Region: 742-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00251
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022940   Gene: ENSMMUG00000017423   Transcript: ENSMMUT00000024508
Sequence length 924
Comment pep:known chromosome:MMUL_1:X:44999697:45016972:1 gene:ENSMMUG00000017423 transcript:ENSMMUT00000024508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSA
ELSCRASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEDEEEEDEEEEEK
ASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATR
WMEANQHSLNILGQKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPKSEAEQK
LPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRN
LNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLLQILQAL
HPPLTIDGKTINVEFAKGSKRDMASNEGSRISAASVASTAIAAAQWAISQASQGGEGAWA
TSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGPEASLEP
GADSVSMQAFSRAQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQSPTHPS
SALPPATSPTAQESYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYL
YWDGERRTYVPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWARSLNKQK
ENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLPKLASDDRPSPPR
GLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPSKEALIRHQQLSGLHKQ
NLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGGISTASV
DFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSY
GVTSTESYKETLHKTMVTRFNEAQ
Download sequence
Identical sequences ENSMMUP00000022940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]