SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023024 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023024
Domain Number 1 Region: 971-1180
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000398
Family WD40-repeat 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023024
Domain Number - Region: 524-577
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00127
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 41-176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00513
Family BAR domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023024   Gene: ENSMMUG00000017496   Transcript: ENSMMUT00000024597
Sequence length 1343
Comment pep:known_by_projection chromosome:MMUL_1:20:1693268:1756710:1 gene:ENSMMUG00000017496 transcript:ENSMMUT00000024597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNSQTESSLPGRSRKERPTSLNVFPLADGTVRAQMGGKLVPAGDHWHLSDLG
QLQSSSSYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYG
VGSKSSKRAREKRDSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCPETRL
DRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGETSTPSVSGMGKEV
GNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELE
EELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKE
RLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHY
KSPTTAGFSQRRSHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGR
LQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWKP
NEDDGGNGVKPAPGRDPLTCDREGDGEPKSAHGSPEKKKAKELPEMDATSSRVWILTSTL
TTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDPGVD
GVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVATIANGKVNPSQSTEEATEATE
VPDPGPSEPETATLRPGPLTEHVFTDPAPTPSSGPQPGSENGPEPGSSSTQPEPEPSGDP
AGAGSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGT
LAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKVHVIQPKTMQIEAK
APASQQSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSK
MLGTGKLGFSFVRITALLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPT
SGEGARPGGIIHVYGDDSSDRAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATL
NGSVLDSPAEGPGPAAPASEAEGQKLRNVLVLSGGEGYIDFRIGDGEDDETEEGTGDISQ
VKPVLSKAERSHIIVWQVSYTPE
Download sequence
Identical sequences ENSMMUP00000023024 ENSMMUP00000023024 9544.ENSMMUP00000023024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]