SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023158 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023158
Domain Number 1 Region: 37-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000153
Family I set domains 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023158   Gene: ENSMMUG00000017593   Transcript: ENSMMUT00000024744
Sequence length 198
Comment pep:known chromosome:MMUL_1:14:116686666:116697866:1 gene:ENSMMUG00000017593 transcript:ENSMMUT00000024744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYHVSISGTTVILTCSQHLGSEVQWQ
HNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDVMA
VATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYE
PIRKGQQDLYSGLNQRRI
Download sequence
Identical sequences G7NCB9
ENSMMUP00000023158 9544.ENSMMUP00000023158 ENSMMUP00000023158 XP_014971302.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]