SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023207 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023207
Domain Number 1 Region: 124-153,185-336,363-423,457-490
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000863
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023207   Gene: ENSMMUG00000017636   Transcript: ENSMMUT00000024797
Sequence length 622
Comment pep:known_by_projection chromosome:MMUL_1:11:13419964:13456864:1 gene:ENSMMUG00000017636 transcript:ENSMMUT00000024797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQKNGGVKNGKSPLGEAPEP
DSDAEVAEAAKPHLSEVTTEGYPSEPLGGLEQKAASSLVSYVRTSVFLLTLGISMILVLL
CAFLIPCPPRDLHSTWSRHLGSQGGGDLSPLELADVNGDGLRDVLLSFVMSRNGSAVGGS
RPAANLVCLSGMNGSTLWSSLLPEEARDITCLELMPGSLAETVCLVTGTHKMLSAFNATS
GKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQPDLCFLLVSGRTGSPV
GRPVKYNVVGVGNLIGPQVYITTNGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSLQI
EEPEWEKRRSINLSELIDVYSDGVELLQMVKAPDSNCSNLLITTRQGLVLLRGQNLTPYW
TLRLQGLRSQPTPGYFTDDQTLDFLLQIQDGVGMKKMMVVDGDSGSVVWSYRAPCHMKET
PATSAVTSDRKSVFLFWAEGLSAASPNSDIILGTEPPSLHHLYLLHPAFPSILLDLANTT
GTVTASEVGINDLWKDAFYVTRTTGPSSEGHPAALVVSKLSLRWALMEGQMAQLQESTPK
IGRGELRRFLSRIKFVEAPYEI
Download sequence
Identical sequences F6UQ54
XP_001087297.1.72884 ENSMMUP00000023207 ENSMMUP00000023207 9544.ENSMMUP00000023207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]