SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023397 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023397
Domain Number 1 Region: 569-645
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.11e-34
Family Small-conductance potassium channel 0.0000234
Further Details:      
 
Domain Number 2 Region: 417-589
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-17
Family Voltage-gated potassium channels 0.0053
Further Details:      
 
Domain Number 3 Region: 30-123
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000034
Family beta-sandwich domain of Sec23/24 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023397   Gene: ENSMMUG00000017793   Transcript: ENSMMUT00000025006
Sequence length 735
Comment pep:known_by_projection chromosome:MMUL_1:1:133247009:133408509:-1 gene:ENSMMUG00000017793 transcript:ENSMMUT00000025006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQP
QPPQLQQQQQQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRPPPSSNS
TAILHPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMS
SCKYSGGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHH
PNATHNHQHAGTTASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIV
VMVIETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRI
AMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLY
LIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAW
TVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMLAFGTL
LVVSSVSFSCKLVKCSLVLYQLKMDTAGLRQIKNAAANVLRETWLIYKHTKLLKKIDHAK
VRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQI
GSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGV
SSTSFPTPYTSSSSC
Download sequence
Identical sequences ENSMMUP00000023397 ENSMMUP00000023397 9544.ENSMMUP00000023397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]