SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023418 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023418
Domain Number 1 Region: 112-224
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-28
Family C-type lectin domain 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023418   Gene: ENSMMUG00000017814   Transcript: ENSMMUT00000025031
Sequence length 225
Comment pep:known_by_projection chromosome:MMUL_1:14:16038281:16042962:1 gene:ENSMMUG00000017814 transcript:ENSMMUT00000025031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLLFLPVLLLGTVSALHLENDVPHLESLETEADLGQDLASSREQERDLALTEEVTQAE
GEEVKASACQDTFEDEEAMESDPAALDKDFQCPREEDIVEVQGSPRCKACHYLLVRTPTT
FANAQNVCSKCYGGNLLSIHNFNFNYRIQRYASTTNQAQVWIGGILRGWFLWKRFCWTDG
SHWNFAYWSSGQPGNGRGCCVALCTKGGYWRRAKCNKQLPFVCSV
Download sequence
Identical sequences F7E0U0
ENSMMUP00000023418 ENSMMUP00000023418 9544.ENSMMUP00000023418 XP_001103106.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]