SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023463 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023463
Domain Number 1 Region: 98-142
Classification Level Classification E-value
Superfamily LysM domain 0.00000000484
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023463   Gene: ENSMMUG00000017845   Transcript: ENSMMUT00000025079
Sequence length 478
Comment pep:known chromosome:MMUL_1:8:108977688:109210066:1 gene:ENSMMUG00000017845 transcript:ENSMMUT00000025079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLTNVSLLKKKSQSVDINAPGFNPLAAAGKQTPQASKPPAPKTPIIEEEQNNAANTQKH
PSRRSELKRFYTIDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPN
ELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPISPLSPTSSEAEFDKTTNPDVH
PKETTPSSTFTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIM
FDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIEIDQLSGRDFCHS
KKMTGSNTEEIDSRIRDAGNDSASTAPRSTEGSLSEDVFTESELSPIREELVSSDELQQD
KSSGASSESVQTVNQTEVESLTVKSESTGTPGHSRSDTEHSTNEVGTLCHKTDLNNLEMA
IKEGDQIADNFQGISGPKEDSTNIKGNSDQDFFLRENSLHQEESKKENMPCGETAEFK
Download sequence
Identical sequences ENSMMUP00000023463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]