SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023519 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023519
Domain Number 1 Region: 451-641
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-44
Family cAMP-binding domain 0.00024
Further Details:      
 
Domain Number 2 Region: 216-444
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-27
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023519   Gene: ENSMMUG00000017889   Transcript: ENSMMUT00000025140
Sequence length 808
Comment pep:known_by_projection chromosome:MMUL_1:8:89153253:89311550:-1 gene:ENSMMUG00000017889 transcript:ENSMMUT00000025140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSLTKVNKVKPIGENNENEQSSHQNEQDSHPSNQSQQTTAQEQNKGEEKSLKTNSTPV
MSEEPHTNIQDKLSKKNSSGDLTTNPDSQTAAEPTGTVPEQKEMDPEKEGPNSPQNKSPA
APVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKP
TEEHYYRLLCFKVKKMPLTEYLKRLKLPSSIDSYTDRLYLLWLLIVSLAYNWNCWFIPLR
LVFPYQTPDNIHYWLIVDIICDIIYLYDMLFIQPRLQFIRGGDIIVDPNELRKNYRTSTK
FQLDVASIIPFDVCYLFFGFNPIFRANRMLKYTSFFEFNHHLESIMDKAYIYRVIRTTGY
LLFILHINACVYYWASNYEGIGTTRWVYDGEGNKYLRCYYWAVRTLITIGGLPEPQTLFE
IVFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRV
RTWYEYTWDSQRMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLR
LKSILYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAG
GGNRRTANVVAHGFANLLTLDKKTLQEILVHYPDSERILMKKARVLLKQKAKTAEATPPR
KDLAFLFPPKEETPKLFKTLLGGKGKASLARLLKLKQEQAAQKKENSEGEEEGKENEDKQ
KENEDKGKENEDKQKENEDKDKGREPEEKPLDRPECTASPIAVEEETQSVRTVLPRGTSR
QSLIISMAPSAEGGEEVLTIEVKEKAKQ
Download sequence
Identical sequences F7F1T7
XP_001083646.1.72884 ENSMMUP00000023519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]