SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023576 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023576
Domain Number 1 Region: 75-168
Classification Level Classification E-value
Superfamily Immunoglobulin 8.12e-24
Family I set domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023576   Gene: ENSMMUG00000017936   Transcript: ENSMMUT00000025199
Sequence length 175
Comment pep:novel chromosome:MMUL_1:12:83291423:83313068:1 gene:ENSMMUG00000017936 transcript:ENSMMUT00000025199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAINELGQATCAASLTVRPGGSASPFSSPITSDEEYLSPPEEFPEPGETWPRTPTMKT
SPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPD
QRRFAEEAEGGLCQLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGEYLISP
Download sequence
Identical sequences ENSMMUP00000023576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]