SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023593 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023593
Domain Number 1 Region: 34-90
Classification Level Classification E-value
Superfamily Kringle-like 2.74e-17
Family Fibronectin type II module 0.0046
Further Details:      
 
Domain Number 2 Region: 3-46
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000514
Family Fibronectin type II module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023593   Gene: ENSMMUG00000017948   Transcript: ENSMMUT00000025218
Sequence length 90
Comment pep:novel chromosome:MMUL_1:19:54269804:54270626:-1 gene:ENSMMUG00000017948 transcript:ENSMMUT00000025218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGECVFPFHYKNGTYYDCIRSKSRHKWCSLNETYEGYWKYCSAEDFASCVFPFWYRRLIY
WDCTDHGEAFGKKWCSLTKNFNKDRIWKYC
Download sequence
Identical sequences G7NNN7 G7PY10
ENSMMUP00000023593 9544.ENSMMUP00000023593 ENSMMUP00000023593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]