SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023621 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023621
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily POZ domain 1.57e-29
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023621   Gene: ENSMMUG00000017971   Transcript: ENSMMUT00000025248
Sequence length 374
Comment pep:known scaffold:MMUL_1:1099214146073:693:1892:1 gene:ENSMMUG00000017971 transcript:ENSMMUT00000025248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFN
NSRSAVVELPAAVQPQSFQQILSFCYTGRLSMNVGDQFLLMYTAGFLQIQEIMEKGTEFF
LKVSSPSCDSQGLHAEEAPSSEPQSPVAQTSGWPACSTPLPLVSRVKTEQQESDSVQCMP
VAKRLWDSGQKEAGGSSNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVATGAG
QPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQI
CNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLY
DEGDPSEKLELVTG
Download sequence
Identical sequences ENSMMUP00000023621 ENSMMUP00000023621 9544.ENSMMUP00000023621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]