SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023678 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023678
Domain Number 1 Region: 32-231
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.22e-50
Family Ribosomal protein S7 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023678   Gene: ENSMMUG00000018022   Transcript: ENSMMUT00000025312
Sequence length 239
Comment pep:novel chromosome:MMUL_1:16:70552199:70556935:1 gene:ENSMMUG00000018022 transcript:ENSMMUT00000025312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIVKSNLLACGVSFCLSPPLPPPRLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEK
YDRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMKGGNKVLARSLVTQTLEAVKRKQF
EKYHSASAEEQATIERNPYTIFHQALKNCEPVIGLVPILKGGRFYQVPVPLPDQRRRFLA
MKWMITECRENKHRRTLMPEKLSHELLEAFHNRGPVIKRKHEMHKMAEANRALAHYRWW
Download sequence
Identical sequences ENSMMUP00000023678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]