SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023679 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023679
Domain Number 1 Region: 35-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.35e-50
Family Ribosomal protein S7 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023679   Gene: ENSMMUG00000018022   Transcript: ENSMMUT00000025313
Sequence length 242
Comment pep:known chromosome:MMUL_1:16:70551961:70556954:1 gene:ENSMMUG00000018022 transcript:ENSMMUT00000025313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTE
EEKYDRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMKGGNKVLARSLVTQTLEAVKR
KQFEKYHSASAEEQATIERNPYTIFHQALKNCEPVIGLVPILKGGRFYQVPVPLPDQRRR
FLAMKWMITECRENKHRRTLMPEKLSHELLEAFHNRGPVIKRKHEMHKMAEANRALAHYR
WW
Download sequence
Identical sequences A0A1D5QNG0 A0A2K6B0L8
ENSMMUP00000023678 ENSMMUP00000023679 NP_001247987.1.72884 XP_011718110.1.29376 9544.ENSMMUP00000023679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]