SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023760 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023760
Domain Number 1 Region: 76-322
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.27e-90
Family Eukaryotic proteases 0.0000392
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000536
Family Hepsin, N-terminal domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023760   Gene: ENSMMUG00000018079   Transcript: ENSMMUT00000025397
Sequence length 327
Comment pep:known_by_projection chromosome:MMUL_1:3:4265227:4288965:1 gene:ENSMMUG00000018079 transcript:ENSMMUT00000025397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSINHLLPDDKVTALHHS
VYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSSLSQWPWQASLQFQGYHLCGGSVI
APLWIVTAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIAL
MKLTGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISN
KICNHRDVYGGIISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAE
ANKPGVYTRVTSFLDWIHEQMERDLKT
Download sequence
Identical sequences ENSMMUP00000023760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]