SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023794 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000023794
Domain Number - Region: 37-81
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000193
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023794   Gene: ENSMMUG00000018104   Transcript: ENSMMUT00000025432
Sequence length 83
Comment pep:novel chromosome:MMUL_1:19:48018632:48019758:-1 gene:ENSMMUG00000018104 transcript:ENSMMUT00000025432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPSACPHRACIPWQGLLLTASLLTFWNLPTSAQTNIEVVPFNVAEGKEVILLVSNVSR
NLYGYNWYKGERVHANYRIIGYV
Download sequence
Identical sequences ENSMMUP00000023794 ENSMMUP00000023794 9544.ENSMMUP00000023794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]