SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023804 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023804
Domain Number 1 Region: 293-399,471-543,590-757
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.71e-46
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 2 Region: 721-867
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000377
Family Quinoprotein alcohol dehydrogenase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023804   Gene: ENSMMUG00000018112   Transcript: ENSMMUT00000025443
Sequence length 894
Comment pep:known_by_projection chromosome:MMUL_1:14:11480029:11490735:1 gene:ENSMMUG00000018112 transcript:ENSMMUT00000025443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGAAGPGEGPAREALQSLSQRLRVQEQEMELVKAALAEALRLLRLQVPPSSLQVSGTPA
PPGDSFAAPPGLPPTCTPSLVSRGTQTETEVEFKTSPGPPGLSNGPPAPQGASEEPSGTQ
SEGGGSSSSGAGSPGPPGILRPLQPPQRADTPRRNSSSSSSPSERPRQLSRKAISSANLL
RSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYIPSGIRSLEELPSG
PPPETLCLDWVYGYRGRDSRCNLFVLRSGEVVYFIACVVVLYRPGGGPGGPGGGGQRHYR
GHTDCVRCLAVHPDGVRVASGQTAGVDKDGKPLQPVVHIWDSETLLKLQEIGLGAFERGV
GALAFSAADQGAFLCVVDDSNEHMLSVWDCSRGVKLAEIKVRKAPRLGVGCLALSPRLAV
KSGISPYWPGWSQTPGLGDPPALASQSAGITGKYKKPKFIPCFVFLPDGDILTGDSEGNI
LTWGRSASDSKTPGRGGAKETYGIVAQAHAHEGSIFALCLQRDGTVLSGGGRDRRLVQWG
PGLVALQEAEIPEHFGAVRAIAEGLGSELLVGTTKNALLRGDLAQGFSPVIQGHTDELWG
LCTHPSQNRFLTCGHDRQLCLWDGESHALAWSIDLKETGLCADFHPSGAVVAVGLNTGRW
LVLDTETREIVSDVIDGNEQLSVVRYSPDGLYLAIGSHDNVIYIYSVSSDGAKSSRFGRC
MGHSSFITHLDWSKDGNFIMSNSGDYEILYWDVAGGCKQLKNRYESRDREWATYTCVLGF
HVYGVWPDGSDGTDINSLCRSHNERVVAVADDFCKVHLFQYPCARAKAPSRMYGGHGSHV
TSVRFTHDDSHLVSLGGKDASIFQWRVLGAGGAGPAPATPSRTPSLSPASSLDV
Download sequence
Identical sequences ENSMMUP00000023804 ENSMMUP00000023804 9544.ENSMMUP00000023804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]