SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023820 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000023820
Domain Number - Region: 80-120
Classification Level Classification E-value
Superfamily LysM domain 0.00445
Family LysM domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023820   Gene: ENSMMUG00000018124   Transcript: ENSMMUT00000025461
Sequence length 296
Comment pep:known_by_projection chromosome:MMUL_1:7:79767161:79773028:-1 gene:ENSMMUG00000018124 transcript:ENSMMUT00000025461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHKELLTKTFQGPAVVCRTPTSHVYTFKNGSGDSEDSSEEESHRVVLRPRGKERQKSGV
HQPHQAGAGDVVLLQRELAQEDSLNKLALQYGCKVADIKKVNNFIREQDLYALKSIKIPV
KNHGILTETHKELKPLLSPSSETTVTVELPDADRAATGTDAQADQLMDFFKGIDQNIEHA
VQSEIFLHESYCIDTSHQPLLPAPPKMPMNGADCGIQWWNAVFIMLLIGIVLPIFYLVYF
KIQASGETPNSLNTTVIPNGSMAMGIVPGQAPRLAVAVPTITSADSQFSQTTQAGN
Download sequence
Identical sequences F7FCE1
XP_014998655.1.72884 ENSMMUP00000023820 ENSMMUP00000023820 9544.ENSMMUP00000023820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]