SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023837 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023837
Domain Number 1 Region: 177-372
Classification Level Classification E-value
Superfamily E set domains 5.13e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000463
Further Details:      
 
Domain Number 2 Region: 68-193
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-23
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023837   Gene: ENSMMUG00000018136   Transcript: ENSMMUT00000025479
Sequence length 422
Comment pep:known chromosome:MMUL_1:3:8913323:9018818:1 gene:ENSMMUG00000018136 transcript:ENSMMUT00000025479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKLTHKLANVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDG
KCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDM
DHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIV
NAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKL
IKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEE
LEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETS
TPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENES
KV
Download sequence
Identical sequences ENSMMUP00000023837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]