SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023912 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023912
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily POZ domain 1.39e-23
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 449-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000166
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 548-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000004
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 346-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000019
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 6 Region: 290-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000209
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 
Domain Number 7 Region: 387-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000222
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023912   Gene: ENSMMUG00000032281   Transcript: ENSMMUT00000025556
Sequence length 688
Comment pep:known_by_projection chromosome:MMUL_1:1:9599366:9607945:1 gene:ENSMMUG00000032281 transcript:ENSMMUT00000025556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSG
GSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSV
GQAAGGQSGLGPPASQNVNSLLKEPAGLQEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSP
AQRESPSSLCGKLKQALKPCSPEDKEPEDCKVPPRPFEAEGGQLQGGSNEWEVVVQVEDD
GDGDYMSEPEAVLTRRKSNVIRKACAAEPALSAGSLAAEPAENRKGTAVPVECPTCHKKF
LSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFR
RRMELRVHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHACPTCAKCFLSRT
ELQLHEAFKHRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPHVCEFCSHAFTQKANL
NMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCEFCEQRFTEKGPLLRHV
ASRHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIH
DRVENYNPRQRKLRNLIIEDEKMVVVALQPPAELEVGSAEVIVESLAQGGLASQLPGQRL
CAEESFTSPGVLEPSLIITAAVPEDCDT
Download sequence
Identical sequences A0A096NQF9 A0A1D5RI52 A0A2K6DKL3
ENSMMUP00000023912 9544.ENSMMUP00000023912 XP_001094007.1.72884 XP_011735818.1.29376 ENSMMUP00000023912 ENSPANP00000015255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]