SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023942 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023942
Domain Number 1 Region: 125-345
Classification Level Classification E-value
Superfamily GFP-like 1.57e-82
Family Domain G2 of nidogen-1 0.000000688
Further Details:      
 
Domain Number 2 Region: 701-957
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-43
Family YWTD domain 0.0000000901
Further Details:      
 
Domain Number 3 Region: 495-602
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.02e-22
Family Thyroglobulin type-1 domain 0.00044
Further Details:      
 
Domain Number 4 Region: 608-678
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.63e-20
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 5 Region: 389-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000264
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 445-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000819
Family EGF-like domain of nidogen-1 0.046
Further Details:      
 
Domain Number 7 Region: 353-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000477
Family EGF-like domain of nidogen-1 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023942   Gene: ENSMMUG00000018201   Transcript: ENSMMUT00000025589
Sequence length 969
Comment pep:known_by_projection chromosome:MMUL_1:7:115025034:115087366:-1 gene:ENSMMUG00000018201 transcript:ENSMMUT00000025589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDRVAGRPVLSPLPVLLLLPLLLSRAAALHPDELFPYGESWGDQLLQEGDDESSAVVK
LANPLHFYEARFSNLYVGTNGIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRG
RVLYHLNGKVSGHLRVGHTPVHFTDVDLHAYVVGNDGRAYTAISHIPQPAAQALLPLTPI
GGLFGWLFALEKPGSENGFSLAGAAFTHDMEVTFYPGEERVHITQTAEGLDPENYLSIKT
NIQGQVPYIPANFTAHISPYKELYHYSDSTVTTTSSRDYSLTFGAINQTWSYRIHQNITY
QVCRHAPRRPAFPTTQQLSVDRVFALYNDEERVLRFAVTNQIGPVEEDSDPTPVNPCYDG
SHMCDTTARCHPGTGVDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCINLPGTYR
CECRSGYEFADDRHTCILITPPPNPCEDGSHTCAPAGQARCVHHGGSAFSCACLPGYAGD
GHQCTDIDECSENRCHPAATCYNTPGSFSCRCQPGYYGDGFQCIPDSTSSLTPCEEQQRH
AQAQYAHPGARFHIPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCG
PPPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFTPLQCHGKSDFCWCVDK
DGREVQGTRSQPGTTPACIPTVAPPMVRPTPRPDVTPPSVGTFLLYTQGQQIGYLPLNGT
RLQKDAAKTLLSLHGSIIVGIDYDCRERMVYWTDVAGRTISRASLELGAEPETIVNSGLI
SPEGLAIDHIRRTMYWTDSVMDKIESALLDGSERKVLFHTDLVNPRAIAVDPIRGNLYWT
DWNREAPKIETSSLDGENRRILINTDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGT
GRRVIHNNLKYPFSIVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAV
YPYCPTGKK
Download sequence
Identical sequences ENSMMUP00000023942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]