SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024022 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024022
Domain Number 1 Region: 6-100
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.15e-20
Family Phosphate binding protein-like 0.00000264
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024022
Domain Number - Region: 108-139
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00239
Family Phosphate binding protein-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024022   Gene: ENSMMUG00000018272   Transcript: ENSMMUT00000025677
Sequence length 140
Comment pep:known chromosome:MMUL_1:5:149442215:149586618:1 gene:ENSMMUG00000018272 transcript:ENSMMUT00000025677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYG
IATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKVSPINLAVLKLS
EQGVLDKLKNKWWYDKGECG
Download sequence
Identical sequences ENSMMUP00000024022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]