SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024057 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024057
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.0000000343
Family 4HBT-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024057   Gene: ENSMMUG00000018302   Transcript: ENSMMUT00000025716
Sequence length 95
Comment pep:known_by_projection chromosome:MMUL_1:8:145270540:145278704:1 gene:ENSMMUG00000018302 transcript:ENSMMUT00000025716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEPFEVRTRLLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVE
PPELPADLQHWISYNEASSQLLRMESGLSDVTKDQ
Download sequence
Identical sequences ENSMMUP00000024057 9544.ENSMMUP00000024057 ENSMMUP00000024057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]