SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024062 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024062
Domain Number 1 Region: 95-213
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-33
Family C-type lectin domain 0.000000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024062   Gene: ENSMMUG00000018305   Transcript: ENSMMUT00000025721
Sequence length 216
Comment pep:known chromosome:MMUL_1:11:10529009:10544610:-1 gene:ENSMMUG00000018305 transcript:ENSMMUT00000025721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWIRGRRPRHNLEMSEFHNYKLGLAKSDFSTRCQKQRCPVIKSKCRENASPLFFCCFIA
VAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHISTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV
Download sequence
Identical sequences F7GSH9 G7PJT6
ENSMMUP00000024063 XP_015006476.1.72884 9544.ENSMMUP00000024062 ENSMMUP00000024062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]