SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024076 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024076
Domain Number 1 Region: 76-232
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-33
Family C-type lectin domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024076   Gene: ENSMMUG00000003587   Transcript: ENSMMUT00000025735
Sequence length 233
Comment pep:known chromosome:MMUL_1:11:10634246:10643045:-1 gene:ENSMMUG00000003587 transcript:ENSMMUT00000025735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNQGVIYSDLNLPPNPKRQQQKPKGNTSSILVTEQEITYAELNLQKTSQDFQGNYKTNH
CKDLPSVPEKLIAGILGIICLILMASVVTIVVIPSTLTQKHNNSSLNTRTQKACHCGHCP
EEWITYSNSCYYIGKEKRAWAESLLACTLKNSSLLSIDNEEEMKFLTAILPSSWIGVFRN
SSQHPWVTINGLTFKHEIKESDNAEHNCAMLHARGLKSDECGSSKIYHCKHKL
Download sequence
Identical sequences ENSMMUP00000024074 ENSMMUP00000024076 ENSMMUP00000004784 9544.ENSMMUP00000024074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]