SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024087 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024087
Domain Number 1 Region: 77-141
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000616
Family C-type lectin domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024087   Gene: ENSMMUG00000018317   Transcript: ENSMMUT00000025747
Sequence length 156
Comment pep:known scaffold:MMUL_1:1099214734781:13871:16046:-1 gene:ENSMMUG00000018317 transcript:ENSMMUT00000025747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGSEQEIFQVELNLQNPSLNHQGIDQIYD
CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPYIIPEQSNSSLNTRTQKVRHCGHCP
EEWITYSNSCYYIGKEKRTWQRVCWPVLQRTPVCFL
Download sequence
Identical sequences ENSMMUP00000024087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]