SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024090 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024090
Domain Number 1 Region: 110-245
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-33
Family C-type lectin domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024090   Gene: ENSMMUG00000018317   Transcript: ENSMMUT00000025750
Sequence length 246
Comment pep:known scaffold:MMUL_1:1099214734781:10342:16070:-1 gene:ENSMMUG00000018317 transcript:ENSMMUT00000025750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGSEQEIFQVELNLQNPSLNHQGIDQIYD
CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFPEQSNSSLNTRTQKVLEQNNSFPN
TRTQKVRHCGHCPEEWITYSNSCYYIGKEKRTWAESLLACTSKNSSLLSIDNEEEMKFLT
AILPSSWIGVFRNSSHHPWVTINGLTFKHEIKNSDNAEHNCAMLHARGLKSNQCESTVIY
HCKHKL
Download sequence
Identical sequences Q9MZK2
ENSMMUP00000024090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]