SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024114 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024114
Domain Number 1 Region: 885-1077
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-46
Family cAMP-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 651-876
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.13e-25
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024114   Gene: ENSMMUG00000018340   Transcript: ENSMMUT00000025775
Sequence length 1247
Comment pep:known_by_projection chromosome:MMUL_1:20:56238831:56321902:-1 gene:ENSMMUG00000018340 transcript:ENSMMUT00000025775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGWVQRVLPQPPGTPRKTKMQEEEKVEPEPELEAEVEPEPNPEEAETESESMPPEESLK
EEEVAVADPSPQETKEAALTSAISLQAQGAESSEMNSPSRRVLTWLMKGVEKVIPQPVHS
VTEDPAQILGHGSTGDTGCTDEPNEALKAQYMRPGSRLLLWLEQNLERVLPQPPRSSEVW
RDEPAVATGAASDPVPPGRPQETGPKLQARESAPLPTAIPLQPKEEPKEVPAPEPQPSSQ
AQASSLPPPRDTARLVAWVLHRLEMALPQPVLHGKIGEQEPDSPGICDVQTISILPGGQV
EPDLVLEEVEPHWEDAHQDVSASSQGTELVPAYEEENKAVEKMPRQLDTYEEPKRTEEEA
PKKKEELPQKQVTGVLLDSCVASQVGVGQSEEDRTWPQSASDQKLWEEAGEEAEKEAEEK
AKEEAEEETEKEHQDHAETKEEPEAEAKAASSGVPATKEHPEVQVEDTDADSCPLLVEKN
PPSPVLPPPSPAKSDTLAVPSSALGTHRKKLPSEDDEAEELKALSPAESPVVAWSDPTTP
KDTDGQDRAASAASTNSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAK
KAPEPAPATKPAEAEPVEEEHYCDMLCCKFKRRPWKKYQFPQSIDPLTNLMYILWLFFVV
MAWNWNCWLIPVRWAFPYQTPDNIHLWLLIDYLCDLIYFLDITVFQIRLQFVRGGDIITD
KKDMRNNYLKSRRFKMDLLSLLPLDFLYLKVGVNPLLRLPRCLKYMAFFEFNNRLESILS
KAYVYRVIRTTAYLLYSLHLNSCLYYWASAYEGLGSTHWVYDGVGNSYIRCYYFAVKTLI
TIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYM
NFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKVALFQ
GCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKA
GSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRML
KNNNKPKEEKSVLILPPRAGTPKLFSAALAMTGKMGDKGAKGGKLAHLRARLKELAALEA
AAKQQELLEQAKSSQDAKGEEGSAALDRPTPPKEATPDPPAPQTPPEPLGSPPRSPPPAS
LGRPEGEEEGVAQPEEHSVRIRMSPGPEXGEQILSVEMPEEKEEKVE
Download sequence
Identical sequences ENSMMUP00000024114 ENSMMUP00000024114 9544.ENSMMUP00000024114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]