SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024214 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024214
Domain Number 1 Region: 15-195
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.43e-82
Family MHC antigen-recognition domain 0.000000049
Further Details:      
 
Domain Number 2 Region: 198-290
Classification Level Classification E-value
Superfamily Immunoglobulin 5.58e-32
Family C1 set domains (antibody constant domain-like) 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024214   Gene: ENSMMUG00000003765   Transcript: ENSMMUT00000025877
Sequence length 354
Comment pep:known scaffold:MMUL_1:1099214731354:3142:24528:1 gene:ENSMMUG00000003765 transcript:ENSMMUT00000025877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSGALALTETWAGSHSLRYFSAGTSRPGRGEPRFISVGYVDDTQFFVRFDSDAESPRME
PRAPWMEQEGPEYWEEQTRIAKEAAQTFRGNLRTLRGYYNQSETGSHTLQWMYGCDLGPD
GRLLRGYDQSAYDGRDYIVLNEDLRSWTAADMAAQNTQRKWEAARAAERQRAYLEGECLE
WLRRYLENGKEMLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQ
DTELVETRPGGDGTFQKWAAVVVPSGEEHRYRCHVQHEGLPEPVTLRWEPSSQSTIPIVG
IVVGLAVLAVVVTGAVVAAVMWRRKSSGREGVRGSYSQAACSNSAQSSYVSLMD
Download sequence
Identical sequences ENSMMUP00000024214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]