SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024274 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024274
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.28e-60
Family Rhodopsin-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024274   Gene: ENSMMUG00000018452   Transcript: ENSMMUT00000025941
Sequence length 281
Comment pep:novel chromosome:MMUL_1:1:137416946:137417857:-1 gene:ENSMMUG00000018452 transcript:ENSMMUT00000025941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHVNHNWTQSFILAGFTTTGTLQLLAFLGTLCIYLLSLAGNILIIVLVQLDSGLFTPMY
FFISVLSFVEVWYLYALFYVFHSLGMTECYLLGVMALDRYLAICFPLHYHALMSRQVQLR
LAGATWVAGFSAALVPATLTATLPFCLKEVAHYFCDLAPLMRLACVDTSWHTRAHGAVIG
VATGCNFVLILGLYGGILNAVLKLPSAASRAKAFSTCSSHMTVVALFYASAFTVYVGSPG
SRSEGTDKLIALVYALVTPFLNPIIYSLRNKEVKEALRRVI
Download sequence
Identical sequences ENSMMUP00000024274 9544.ENSMMUP00000024274 ENSMMUP00000024274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]