SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024299 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024299
Domain Number 1 Region: 111-233
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-18
Family C1 set domains (antibody constant domain-like) 0.02
Further Details:      
 
Domain Number 2 Region: 32-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000445
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024299   Gene: ENSMMUG00000018473   Transcript: ENSMMUT00000025969
Sequence length 275
Comment pep:known_by_projection chromosome:MMUL_1:10:34930589:34957368:-1 gene:ENSMMUG00000018473 transcript:ENSMMUT00000025969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPASWSHPPGPFLLLTLLLGFTVAGEEELQMIQPEKLLLVAVGESATLNCTVTSLLPV
GPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADAGTYYCVK
FRKGSPENVEFKSGPGTEMALRAKPSAPVVSGPAARATPEHTVSFTCKSHGFSPRDITLK
WFKNGNELSDFQTNVDPAGQSVSYSIRSTARVVLAPWDVRSQVTCEVAHVTLQGDPLRGT
ANLSEAIRGPASSLTVLLLIAVLLGPIYVPWKQKS
Download sequence
Identical sequences F7HCN2
ENSMMUP00000024299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]