SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024304 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024304
Domain Number 1 Region: 248-337
Classification Level Classification E-value
Superfamily Immunoglobulin 2.58e-19
Family C1 set domains (antibody constant domain-like) 0.0097
Further Details:      
 
Domain Number 2 Region: 34-149
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-17
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 
Domain Number 3 Region: 143-235
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-16
Family C1 set domains (antibody constant domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024304   Gene: ENSMMUG00000018474   Transcript: ENSMMUT00000025974
Sequence length 397
Comment pep:known_by_projection chromosome:MMUL_1:10:34868322:34887195:-1 gene:ENSMMUG00000018474 transcript:ENSMMUT00000025974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIPASWSHLPGPFLLMNLLLGGLPGVLGEEELQVIQPEKSVSVTAGESATLNCTVTSLI
PVGPIQWFRGVGPGRELIYSQKEGHFPRVTIVSDPTKRNNMDFSIHISNITPADAGTYYC
VKFRKGSPDVELKSGAGTELSVRAKPSAPVVSGPTARATPEHTVSFTCESHGFSPRDITL
KWFKNGNELSDFQTNVDPAGKSVSYSIRSTARVVLTRRDVHSQVICEVAHVTLQGDPLRG
TANLSEAIRVPPTLEVFQRPMRAENQANVTCQVRKFYPQRLLLTWLENGNVSQTETASTL
TENKDGTYSWRSWLLVNTCAHRDGVVLTCQVEHDGQPAVSKSHALEVSAHQKEQCSDTTS
GPVLAPTAPLLIALLLGPKVLLVVGVSVIYVYWKQKA
Download sequence
Identical sequences F7HCP1
ENSMMUP00000024304 XP_015004816.1.72884 ENSMMUP00000024304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]