SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024383 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024383
Domain Number 1 Region: 13-350
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-108
Family ALDH-like 0.00000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024383   Gene: ENSMMUG00000018533   Transcript: ENSMMUT00000026056
Sequence length 385
Comment pep:known_by_projection chromosome:MMUL_1:14:6790745:6794461:1 gene:ENSMMUG00000018533 transcript:ENSMMUT00000026056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDEPGSTNLFMKLDSVFIRKEPFGLVLIIAPWNYPVNLTLVPLVGALAAGNCVVLKPSE
ISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKFDYIFFTGSPRVGKIVMTAAA
KHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLL
PALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGHVAIGGQSDESDRYIAPTVL
VDVQETEPVMQEEIFGPILPIVNVRSVDEAIEFINRQEKPLALYAFSNSSQVVNQMLERT
SSGSFAGNDGFLYVSLLSVPLGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEI
RYPPYTDWNQQLLRWGMGSNSCTLL
Download sequence
Identical sequences F7A202
9544.ENSMMUP00000024383 ENSMMUP00000024383 ENSMMUP00000024383 XP_014969035.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]