SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024419 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024419
Domain Number 1 Region: 283-385
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.86e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024419
Domain Number - Region: 137-194
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0405
Family BphP N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024419   Gene: ENSMMUG00000018562   Transcript: ENSMMUT00000026096
Sequence length 386
Comment pep:novel chromosome:MMUL_1:1:10814497:10834148:1 gene:ENSMMUG00000018562 transcript:ENSMMUT00000026096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRGDLETPRGEPPGTGGRGAEDEALGEESGERWSPEFHLQRKLAESSHSEQQDRNRVS
EELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANGEFFQILSQNGAPQADVTM
YSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHVSEQAALILNRKKDVLASSHFVDLLA
PQDVRVFYAHTARAQLPFWNNWTQRAPRYECAPVKPFFCRIRGGEDRKQEKRHSPFRIIP
YLIYVHRPGQPESESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTPGCVFLEVDERAV
PLLGYLPQDLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYIIL
DSSWSSFVNPWSRKVSFIIGRHKVRT
Download sequence
Identical sequences ENSMMUP00000024419 9544.ENSMMUP00000024419 ENSMMUP00000024419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]