SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024583 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024583
Domain Number 1 Region: 33-130
Classification Level Classification E-value
Superfamily POZ domain 1.91e-27
Family Tetramerization domain of potassium channels 0.00000207
Further Details:      
 
Domain Number 2 Region: 159-187,214-312
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-17
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024583   Gene: ENSMMUG00000018680   Transcript: ENSMMUT00000026262
Sequence length 356
Comment pep:known_by_projection chromosome:MMUL_1:1:113654721:113692774:-1 gene:ENSMMUG00000018680 transcript:ENSMMUT00000026262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLER
RPLQSQESKQGRQHLNTSHDCTLGNNLVTGMTVQWTRASGPDNRQTPAVTTLHRMY
Download sequence
Identical sequences A0A2K5X884 F6ZXV6
ENSMMUP00000024583 ENSMMUP00000024583 9544.ENSMMUP00000024583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]